PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc03484.1.g00090.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family MYB
Protein Properties Length: 329aa    MW: 35699.2 Da    PI: 8.3177
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc03484.1.g00090.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.62.4e-1758105148
                                   TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
               Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                                   +g+WT+eEd+ lv +v+++G+g+W+++++  g+ R+ k+c++rw +yl
  Zmw_sc03484.1.g00090.1.am.mk  58 KGPWTPEEDLVLVSYVQEHGPGNWRAVPAATGLARCSKSCRLRWTNYL 105
                                   79********************************************97 PP

2Myb_DNA-binding45.12.3e-14111156148
                                   TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
               Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                                   rg ++  Ed l+v++ ++lG++ W++Ia++++  Rt++++k++w+++l
  Zmw_sc03484.1.g00090.1.am.mk 111 RGGFSDREDRLIVHLQALLGNR-WAAIASYLP-DRTDNDVKNYWNTHL 156
                                   78899*****************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.3E-2349108IPR009057Homeodomain-like
PROSITE profilePS5129425.58953109IPR017930Myb domain
SuperFamilySSF466895.5E-3055152IPR009057Homeodomain-like
SMARTSM007174.3E-1357107IPR001005SANT/Myb domain
PfamPF002493.6E-1658105IPR001005SANT/Myb domain
CDDcd001672.72E-1160105No hitNo description
Gene3DG3DSA:1.10.10.601.7E-22109160IPR009057Homeodomain-like
PROSITE profilePS5129419.043110160IPR017930Myb domain
SMARTSM007175.9E-15110158IPR001005SANT/Myb domain
PfamPF002493.5E-13111156IPR001005SANT/Myb domain
CDDcd001676.02E-12114156No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 329 aa     Download sequence    Send to blast
MPRSNPVLRA VCINKIPWTL VFAYTTHGNC CRSQLLVGVV ASIPMGRPPC CDREGVKKGP  60
WTPEEDLVLV SYVQEHGPGN WRAVPAATGL ARCSKSCRLR WTNYLRPGIR RGGFSDREDR  120
LIVHLQALLG NRWAAIASYL PDRTDNDVKN YWNTHLKKKL GALQQQQQQP SGTKGKWELR  180
LQTDIDLARR ALREALSVDV SGTTTPTTTT SPPVRSNEPA AVQAPSYALT AGNFATMLDG  240
WATTTTPAES ASGSSSDLTD CSAAGSTSTS ASNRAARDGG PLFRREADAD VPLSAIESWL  300
LGDDGCGEQL VSAQEGLLLD ATLHYGFYR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C4e-275616025128MYB TRANSFORMING PROTEIN
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001149309.11e-102myb transcription factor MYB30
RefseqXP_008658625.11e-102PREDICTED: myb transcription factor MYB30 isoform X1
SwissprotP813924e-92MYB06_ANTMA; Myb-related protein 306
TrEMBLA0A0A9DP431e-108A0A0A9DP43_ARUDO; Uncharacterized protein
STRINGGRMZM2G098179_P011e-102(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP22938296